PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G100100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 386aa    MW: 42814.8 Da    PI: 6.0818
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G100100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.31.3e-161461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       rg WT+eEd +++ +v  +G+g+W++++++ g++R++k+c++r+ +yl
  Aqcoe3G100100.1.p 14 RGLWTAEEDAKILAYVSDHGPGNWTSVPKKAGLRRCGKSCRLRYTNYL 61
                       788*******************************************97 PP

2Myb_DNA-binding51.42.5e-1668110246
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        +++T++E+el++++++  G++ W++Ia+ ++ gRt++++k++w++
  Aqcoe3G100100.1.p  68 DNFTPQEEELIINLHAAIGSR-WSLIAQQLP-GRTDNDVKNHWNT 110
                        68*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-23564IPR009057Homeodomain-like
PROSITE profilePS5129424.636965IPR017930Myb domain
SuperFamilySSF466892.49E-2911108IPR009057Homeodomain-like
SMARTSM007179.4E-141363IPR001005SANT/Myb domain
PfamPF002496.1E-151461IPR001005SANT/Myb domain
CDDcd001674.83E-111761No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2365116IPR009057Homeodomain-like
SMARTSM007171.3E-1466114IPR001005SANT/Myb domain
PROSITE profilePS5129419.17766116IPR017930Myb domain
CDDcd001673.78E-1169112No hitNo description
PfamPF002491.3E-1469110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MGRPPCCDKS NVKRGLWTAE EDAKILAYVS DHGPGNWTSV PKKAGLRRCG KSCRLRYTNY  60
LRPNLKHDNF TPQEEELIIN LHAAIGSRWS LIAQQLPGRT DNDVKNHWNT KLKKRLCGMG  120
IDPVTHKPIS QILHDYENIG GIPKPGTRIG TLNRDLKNAF MVKHEPHDGI SGITNPSMIP  180
IQSLSMEPLF SSHFNINSNN HSLELLAQFQ AIKLVTDQAS HCANLERFQP HLFSSEGSSS  240
SSSCSSNVLQ LNSQPVINPN CQTSSVPNTP CSPFSWSEFL LEDAFLPPNQ QEQQDVQGLS  300
YIESSSQLAQ TEFNNIGNVT LEGVRDMGYS TYDYTNRGYP ITSIGETNDA FGASSSSGSS  360
FVEALLDRDS EMSWDFPSLL EEPYY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-26141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010264963.11e-146PREDICTED: transcription factor MYB76
TrEMBLB9IEI51e-122B9IEI5_POPTR; Uncharacterized protein
STRINGPOPTR_0015s07900.11e-121(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.19e-76MYB family protein